PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00068.1.g02590.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 444aa    MW: 49760.8 Da    PI: 5.8906
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00068.1.g02590.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like63.83.2e-2072123355
                       G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   rl Wt eL e+F+ea+e L G ++A+P++i++ m+vk+Lt ++++SHLQk+R+
  Zjn_sc00068.1.g02590.1.sm.mk  72 RLIWTVELQEKFLEAIEVL-GDKNAVPSRIVKQMNVKDLTAKQIASHLQKHRS 123
                                   99*****************.9******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.95567126IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-1968126IPR009057Homeodomain-like
SuperFamilySSF466896.63E-1571126IPR009057Homeodomain-like
TIGRFAMsTIGR015576.0E-1972124IPR006447Myb domain, plants
PfamPF002491.1E-675122IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MCANDNEEAS SECMAVGACF HLPKPLTAGS FNMLRDTARQ HKSRRAAIKQ QHLKGHTNST  60
KRDRFHSKKL DRLIWTVELQ EKFLEAIEVL GDKNAVPSRI VKQMNVKDLT AKQIASHLQK  120
HRSRVKAYQR KFRQNANKKA VPELIRSEHN DSTTVCITPK VAADIRELYP SRLWTNVKKM  180
LAEAVSLKAY SYTCISGIFR DDTSSVWDKY HKSLQNCLSS RRWEYEQPTK GKDVVRYEGS  240
SSEGQETAGE IGHGVPFESS GSNSMLTSSG QTDKNNLTET AVTYPSDGCL HNDALLNDTN  300
KSSSTQMYMA GPADDREELI SFWTSHMNPQ EPLNVSVEDL LQIDEAWNEA LVWGTQPSLV  360
NVIEPITQET IVEETLVPDP VMQSAQTQEA AVGDAQVPDP VVQFVQTQEV AVGAAPLHDH  420
VMQFAQDDVY WSLSPSLADY DMLF
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP130171928
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44190.13e-13GOLDEN2-like 2